PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G121900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 229aa    MW: 26150.5 Da    PI: 9.3394
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G121900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181057148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g WT+eEd++l d++  +G+g+W++Iar  g++R++k+c++rw +yl
  Aqcoe3G121900.1.p 10 KGLWTEEEDKILMDYISVHGKGRWSRIARITGLKRCGKSCRLRWMNYL 57
                       678*******************************************97 PP

2Myb_DNA-binding59.57.2e-1963108148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g +++eE++l+++++k+lG++ W++Ia +++ gRt++q+k++w+++l
  Aqcoe3G121900.1.p  63 KGDFSEEEEDLIIRLHKLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 108
                        689*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.724157IPR017930Myb domain
SuperFamilySSF466893.49E-319104IPR009057Homeodomain-like
SMARTSM007176.9E-15959IPR001005SANT/Myb domain
PfamPF002493.2E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-241164IPR009057Homeodomain-like
CDDcd001678.01E-121357No hitNo description
PROSITE profilePS5129428.97558112IPR017930Myb domain
SMARTSM007175.5E-1862110IPR001005SANT/Myb domain
PfamPF002491.3E-1763108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2765112IPR009057Homeodomain-like
CDDcd001677.89E-1366108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEKEGSYYKK GLWTEEEDKI LMDYISVHGK GRWSRIARIT GLKRCGKSCR LRWMNYLSPN  60
VKKGDFSEEE EDLIIRLHKL LGNRWSLIAG RVPGRTDNQV KNHWNTHLSK KLGVKRVQHK  120
ASTSSLKVPR EHKEERESLN LVTFSNPKIS SSDKNDGVTE PIVDNHISSR TPVLEAFSTQ  180
HQAELNDQSS IVSSFWFNSD NLNLSAPSLV DVLLDGYSPD VIWNDLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301011227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279128.21e-79PREDICTED: transcription factor WER
SwissprotQ9SEI02e-70WER_ARATH; Transcription factor WER
TrEMBLA5BI149e-80A5BI14_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g08480.t014e-79(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.19e-72myb domain protein 66